Protein Info for SMa2389 in Sinorhizobium meliloti 1021

Annotation: OsmC-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 49 to 66 (18 residues), see Phobius details TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 8 to 136 (129 residues), 166.1 bits, see alignment E=2.6e-53 PF02566: OsmC" amino acids 39 to 135 (97 residues), 59 bits, see alignment E=2.6e-20

Best Hits

Swiss-Prot: 52% identical to OHR_XANAC: Organic hydroperoxide resistance protein (ohr) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: None (inferred from 100% identity to sme:SMa2389)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XG3 at UniProt or InterPro

Protein Sequence (138 amino acids)

>SMa2389 OsmC-like protein (Sinorhizobium meliloti 1021)
MTTQEKVLYTGKTHTTGGREGFARSDDAQLDVRLSPPGGGKAGTNPEQLFAAGWSACFIG
ALGLAASKHKLTLPAETAVDAEVDLAKSDGGFFLQARLAVSLPGIDADLARSLIAEAHQT
CPYSKATRGNIEVDLTLA