Protein Info for SMa2359 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 248 (241 residues), 129.8 bits, see alignment E=6.7e-42

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to sme:SMa2359)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XH6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>SMa2359 hypothetical protein (Sinorhizobium meliloti 1021)
MEDFILFALVGFLAQVIDGALGMAYGVICSTVLLAFGVPPAQASASVHAAELFTTAASGS
AHLYHRNIDWKLFWRLIPFGIAGGMLGAFVVTSFDGDQVKPFVTAYLAVIGAWLLYRSFH
RIPTNPVKLRIVAPLGATAGFLDAAGGGGWGPVATTGLLGAGGQPRFVIGTVNASEFLIA
LSVSLSFLATVLTGHWEQAGDFRDHLTSIGGLITGGVVAAPFAGWVVKALKEKTLLRLVG
SLITLLAGYQTLELTGFL