Protein Info for SMa2351 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase, molybdopterin-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 74% identical to PAOB_ECOLI: Aldehyde oxidoreductase FAD-binding subunit PaoB (paoB) from Escherichia coli (strain K12)

KEGG orthology group: K11178, xanthine dehydrogenase YagS FAD-binding subunit [EC: 1.17.1.4] (inferred from 100% identity to sme:SMa2351)

MetaCyc: 74% identical to aldehyde dehydrogenase, FAD-binding Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, FAD binding subunit YagS" in subsystem Purine Utilization

MetaCyc Pathways

purine nucleotides degradation II (aerobic) (11/11 steps found)
adenosine nucleotides degradation II (5/5 steps found)
purine nucleotides degradation I (plants) (10/12 steps found)
adenosine nucleotides degradation I (7/8 steps found)
guanosine nucleotides degradation II (4/4 steps found)
guanosine nucleotides degradation III (4/4 steps found)
inosine 5'-phosphate degradation (4/4 steps found)
superpathway of purines degradation in plants (14/18 steps found)
ureide biosynthesis (6/7 steps found)
superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
guanosine nucleotides degradation I (3/4 steps found)
purine nucleobases degradation II (anaerobic) (16/24 steps found)
caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)
theophylline degradation (1/9 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4 or 1.2.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XI0 at UniProt or InterPro

Protein Sequence (316 amino acids)

>SMa2351 oxidoreductase, molybdopterin-binding subunit (Sinorhizobium meliloti 1021)
MRAFSYERVSSIGAAARAAAATDGAKFIAGGTNLLDLMKLEIETPTHLVDVNGLGLDRIE
ATREGGLRIGALVRNTDLAADERVRRDYALLSRALLTGASGQLRNRATTAGNLLQRTRCP
YFYDTNQPCNKRQPGSGCSALAGFSRQLAVVGVSDACIASHPSDMAVALRALDAVVETVR
ADGTTRSIPMGDLHRLPGDTPHIEHVLERGELITAVVLPKPAGGKQIYRKVRDRASYAFA
LVSVGAVVQPDGTGRVAVGGIAPKPWRDEAAEKELANGAKAVAAMLLAGARPTEQNAFKL
TLVERALSAVLVEAKG