Protein Info for SMa2349 in Sinorhizobium meliloti 1021

Annotation: xanthine dehydrogenase iron-sulfur-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13085: Fer2_3" amino acids 48 to 140 (93 residues), 27.8 bits, see alignment E=3.1e-10 PF00111: Fer2" amino acids 52 to 103 (52 residues), 39.8 bits, see alignment E=5.2e-14 PF01799: Fer2_2" amino acids 120 to 207 (88 residues), 100.9 bits, see alignment E=5.1e-33

Best Hits

Swiss-Prot: 65% identical to PAOA_ECO57: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (paoA) from Escherichia coli O157:H7

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to sme:SMa2349)

MetaCyc: 65% identical to aldehyde dehydrogenase, Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XI1 at UniProt or InterPro

Protein Sequence (215 amino acids)

>SMa2349 xanthine dehydrogenase iron-sulfur-binding subunit (Sinorhizobium meliloti 1021)
MELDMQSPGALEISRRDLLAASAATVTVVSAHSLGHAQTNASTAPQSTKVTFTVNDERRE
LQLDNRTTLLDALREHLHLTGTKKGCDHGQCGACTVLIEGRRVNACLTLAIMHEGDSITT
LEGLGQPENLHPMQAAFVKHDGFQCGYCTPGQICSSVAMLDEIKANIPSHVTVDLTAPAE
ITPAEIRERMSGNICRCGAYSNIVEAITEVAGRKA