Protein Info for SMa2331 in Sinorhizobium meliloti 1021

Annotation: potassium-transporting ATPase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 249 to 276 (28 residues), see Phobius details amino acids 585 to 608 (24 residues), see Phobius details amino acids 614 to 634 (21 residues), see Phobius details amino acids 646 to 670 (25 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 9 to 674 (666 residues), 1016.1 bits, see alignment E=0 TIGR01494: HAD ATPase, P-type, family IC" amino acids 73 to 343 (271 residues), 110.8 bits, see alignment E=6e-36 amino acids 371 to 600 (230 residues), 156.4 bits, see alignment E=9e-50 PF00122: E1-E2_ATPase" amino acids 110 to 284 (175 residues), 108.1 bits, see alignment E=8.1e-35 PF00702: Hydrolase" amino acids 301 to 528 (228 residues), 87.9 bits, see alignment E=2.4e-28

Best Hits

Swiss-Prot: 100% identical to KDPB_RHIME: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to sme:SMa2331)

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XJ0 at UniProt or InterPro

Protein Sequence (680 amino acids)

>SMa2331 potassium-transporting ATPase subunit B (Sinorhizobium meliloti 1021)
MSNKPTTPNLVDPKILFPAAKAAFVKLDPRQLVRNPVIFVTEAMAALVTLFFVLDVATGG
GSRLFSGQIAAWLWFTVLFATFAEAVAEGRGKAQADFLRHTKSELSARKLVAPEGRETKE
IPATMLKVGDLVLVQAGELIPGDGEVVEGVASVNESAITGESAPVIREAGGDRSAVTGGT
EVLSDWVKVRITTAPGSTFVDRMIALIEGAQRQKTPNEIALSILLSGLTLIFLIAVVTLW
GLASYSATVLSVTVLSALLVTLIPTTIGGLLSAIGIAGMDRLVRFNVIATSGRAVEAAGD
VDTLLLDKTGTITFGNRMASDFLPVPGVTVEELADAALLASLADETPEGRSIVALATGEF
GRGASQTGIDAVVPFTAETRLSGVDHRGRRLRKGAVDSVLRFAGLSDSKIPQEFRQAVDK
VARTGGTPLAVADGNRLLGVVHLKDVVKPGIKERFSELRAMGIRTVMVTGDNPITAAAIA
SEAGVDDFLAEATPEDKLAYIRKEQNGGRLIAMCGDGTNDAPALAQADVGVAMQTGTQAA
REAANMVDLDSSPTKLIEIVEIGKQLLMTRGSLTTFSIANDVAKYFAIIPALFVTTYPAL
GVLNIMGLASPQSAILSAVIFNALIIVALIPLALKGVRYRPVGAAALLRGNLLVYGLGGL
VLPFAGIKLIDLAVSNLNLV