Protein Info for SMa2307 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 10 to 15 (6 residues), see Phobius details amino acids 32 to 32 (1 residues), see Phobius details amino acids 35 to 37 (3 residues), see Phobius details transmembrane" amino acids 16 to 31 (16 residues), see Phobius details amino acids 33 to 34 (2 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 283 (174 residues), 55.3 bits, see alignment E=3.6e-19

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMa2307)

Predicted SEED Role

"ABC transporter sugar permease protein ycjO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XK2 at UniProt or InterPro

Protein Sequence (307 amino acids)

>SMa2307 ABC transporter permease (Sinorhizobium meliloti 1021)
MTSLWRRHRWWLTPTLLILPGAILFAVVILASSVQSLWISLHDWDGFGPMIWIGLGNYRE
LINDPQFYVSLKNNLIWLVMFMLAPPIGLAIALLVNQKIKGMRVVIPLVLASVAVGVVFT
WVYTPEFGLLALIFRAFGANAPALLSDEHLVTFAIVIAALWPQIAFCMVLYLAGLNNLSE
ELIGAGRVDGARGWNMLRHIVLPQLTQVTFIAIAVTVVGALRSFDMISVMTRGGPFGSSS
VLAYQMFEQSIFSYRFGYGAAIASVLFVIMAVLYLVPHAHHPRGRKGRLMYPRPVPETAQ
CEPQGCT