Protein Info for SMa2223 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01266: DAO" amino acids 7 to 342 (336 residues), 200.5 bits, see alignment E=9e-63 PF13450: NAD_binding_8" amino acids 9 to 37 (29 residues), 23.2 bits, see alignment (E = 1e-08)

Best Hits

Swiss-Prot: 100% identical to OOXB_RHIME: Opine oxidase subunit B (ooxB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to sme:SMa2223)

Predicted SEED Role

"Opine oxidase subunit B"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XP5 at UniProt or InterPro

Protein Sequence (368 amino acids)

>SMa2223 oxidoreductase (Sinorhizobium meliloti 1021)
MSDRCELLVIGGGLIGSAIAWGAARKGARVTLLDEGDIAYRASRANFGLVWLQGKGLGHP
DYMHWSIRAGQLWPELSTILLKETGIDIGWRGGGGLHFCLSESEMAARRALIARSSAEGA
AIRIQLLDRDALHEIVPDIGPEVRGASLSDLDGEANPLLTLNALQLAFQQNGGRLVVQFA
ARNIRSEPARGFVVSDANGDEISGRRVVLAAGLGNNELARQVGLKLGLTPERGQIVVTDR
IAPFLRYPSNAIRQTREGTVLLGSSHEDAGFSTGTDVETIARLCRIGTRVFPALRAARLI
RAWGALRIMSPDGLPIYEEAPEMPGAYVVTCHSGVTLASLHALELGPALAEGHLGPAPRS
MRSTRFAL