Protein Info for SMa2203 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 10 to 34 (25 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 256 (174 residues), 56 bits, see alignment E=2.2e-19

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to sme:SMa2203)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XQ5 at UniProt or InterPro

Protein Sequence (264 amino acids)

>SMa2203 ABC transporter permease (Sinorhizobium meliloti 1021)
MTRWDISSIALRLVTFSMMAFLIFPIAVTLIVAVNPREFVLPPNGFTLDWFRAAWSSKTF
LRGMGVSLVLGLAAALIANALALPAAIALARTNFPGKGAINLILMTPLLIPTTILSLALY
IYFVRVGYGSGLVPLLVGHAIHIMPYAVRILTASLLNFDPSYEEAARNVGAGRIRTLFSV
TLPVIRTGLISSLTLCFILSWNDFPISVFLAPPSWTPLPVELYSYIKFQYDAVAAALASS
LILLSAVAMVVIDRLAGLRRVLRS