Protein Info for SMa2197 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 68 to 96 (29 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 66 to 178 (113 residues), 65.3 bits, see alignment E=3e-22 PF00528: BPD_transp_1" amino acids 84 to 283 (200 residues), 79.3 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to sme:SMa2197)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XQ8 at UniProt or InterPro

Protein Sequence (304 amino acids)

>SMa2197 ABC transporter permease (Sinorhizobium meliloti 1021)
MSNDLTLAPTASPDRPMLTYVPASTWKTRFAATLLILLVLYCATMIASNPNFGWDVVADY
LFDSRILWGLSLTVWLTVVTMVIGVVLGTIFAIMAMADNVVISTVANAYIWFFRGTPVLV
QLIFWYNLGALFPQLSVGVPFTSLWVSVPTNTLISPVTAAVLGLGLNEGAYMSEIIRSGL
MSVDPGQRQAAKSLGMTNGKTLWRILLPQAMPVIIPPTGNQTIGMLKTSSLVSVISLADL
LYSAQTIYSRNFQTIPLLIVACIWYLAATTILSAVQVRIERHFARSSQRANITQPRRLFR
QKAR