Protein Info for SMa2125 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 91 to 107 (17 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 59 to 341 (283 residues), 133.8 bits, see alignment E=3.3e-43

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SMa2125)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XT3 at UniProt or InterPro

Protein Sequence (359 amino acids)

>SMa2125 ABC transporter permease (Sinorhizobium meliloti 1021)
MISVQRRSGNSLSWNFACYAAAMLCALVSAAALLHLSGGDVAKAFSSLIVGAFGSQKALL
GSLAKATPLLLVGLGTVIAFRAKIWNIGQEGQVLAGAMCAYWASLWIGPLPYWIAFTVLV
LAGLAGGGALGVLAGVLKTRFGTSEIISTVMLNYIVIFLLAYLLDGGPWMETGVTVAYHQ
SPPVNAMLEWPTLLGQGAHKLHFGFLLALVATVLCAVLLERTPLGYEIRAFGSNPTALRF
RGTDISRLLLVVMLVSGALAGLAGAGELFGTSHRLRAETLLGIGSSGIVVAMVGGLRPSG
AMLAALFFGALKSGAIYMRLQSGTPAGLVSAMEGLVLLFFLCAAVATRIHITVRSEAHA