Protein Info for SMa2111 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 PF00353: HemolysinCabind" amino acids 6 to 40 (35 residues), 27.1 bits, see alignment 1.7e-10 amino acids 41 to 67 (27 residues), 18.9 bits, see alignment (E = 6.3e-08) amino acids 147 to 182 (36 residues), 30.4 bits, see alignment 1.6e-11 amino acids 165 to 200 (36 residues), 27.9 bits, see alignment 9.1e-11 amino acids 184 to 218 (35 residues), 30.2 bits, see alignment 1.8e-11 amino acids 202 to 236 (35 residues), 34.9 bits, see alignment 6e-13 amino acids 219 to 254 (36 residues), 28.5 bits, see alignment 6e-11 amino acids 261 to 285 (25 residues), 12.1 bits, see alignment (E = 8.1e-06) amino acids 288 to 297 (10 residues), 8 bits, see alignment (E = 0.00016) amino acids 374 to 406 (33 residues), 28.8 bits, see alignment (E = 4.7e-11) amino acids 408 to 433 (26 residues), 20.7 bits, see alignment (E = 1.7e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa2111)

Predicted SEED Role

"RTX toxins and related Ca2+-binding proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XT9 at UniProt or InterPro

Protein Sequence (516 amino acids)

>SMa2111 hypothetical protein (Sinorhizobium meliloti 1021)
MTRIVGTSADDTLDGMAEGDRIWSLDGNDVVDGGAGDDFVDGGAGDDALTSSSGFDEFTG
GEGNDRLSFIGVGGAARGGTGVDTLVGDYAAISDAFLFDGMHGHAAFGDLSVKGNHLYFL
DIERLSLTTGIGDDRIIATGFSFVHVHTGAGDDRVETGIGDDQIYAGDGRDLLFGGGGDD
FIHTGQGDDYVNGGNDDDRLEGEDGNDSLVGGRGNDRLDGGSGDDDVNGGDGNDSLTGGL
GSDTVTGGAGDDYLSNSFAAGDILLGGDGNDTLSAGGEDTAYGGWSDLYGGAGDDRLHIY
TDGSLGALDGGEGFDRASIALDDVSAGFVLDASRFGSIEEFNITVKSAYRGVHLSGGNGN
DRLFCFDTYREGPSGNDVLNGRNGDDILVGGSGADSLLGGDGNDSLSGEYHSDRLLGGAG
ADLLTGGSDADTFIWDEASVRNDRSVDRITDFRGGDGDVLLFRGFGGTEFRDFESFLAAS
RDTPEGVYVSFDGDAHGILIQNTLLADLSAADVLFA