Protein Info for SMa2085 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 295 to 320 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 11 to 108 (98 residues), 29.2 bits, see alignment E=9.2e-11 PF00528: BPD_transp_1" amino acids 121 to 325 (205 residues), 144.7 bits, see alignment E=2.7e-46

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to sme:SMa2085)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XV2 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SMa2085 ABC transporter permease (Sinorhizobium meliloti 1021)
MPVLIRIARTLRRTLLQAVPTILGIVILNFFLLQLAPGDAADVLAGEAGSATEESVAALR
ARFGLDSPVLEQLATYLGNLAQFSLGFSPRYGMPVADLIAQRLPGTLTLMAVALFIAILL
GVVLGSLMASFAGRIPDRLLSIFSLLFYSIPSFWIGLMLIVLFSVKLGWLPSGGAATIGS
QLKGFPALLDKARYMVLPATSLALFYVAIYARLTRAAMLEVKNHDFVRTAYAKGLTPFGV
TARHILRNALIPITTMAGMHIGGMLGGAVVVETVYSWPGLGRLAFEAVMGRDFTVLLGIL
LLSSLLVIIANAAVDLVHAWLDPRIGAR