Protein Info for SMa2081 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00005: ABC_tran" amino acids 21 to 179 (159 residues), 111 bits, see alignment E=7e-36 PF08352: oligo_HPY" amino acids 230 to 297 (68 residues), 54.8 bits, see alignment E=9.9e-19 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 230 to 315 (86 residues), 55.9 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 51% identical to Y1094_BRUSU: Putative peptide import ATP-binding protein BRA1094/BS1330_II1086 (BRA1094) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to smk:Sinme_6814)

MetaCyc: 48% identical to dipeptide ABC transporter ATP binding subunit DppD (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XV4 at UniProt or InterPro

Protein Sequence (332 amino acids)

>SMa2081 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MAPLLQVDNLTIGFPRAEPVRNLSFEVGAGETLAIVGESGSGKSLTALALMQLLPRAAQV
TSGRIIFDDRDLLDLDAREMRRLRGREIAMIFQEPMTSLNPVMSIGRQIGEVLKVHEKAS
ARAARERAIELLKLVRIPAAEKRIDDYPHQLSGGMRQRVMIAMAVACRPKLLIADEPTTA
LDVTIQAQVLDLLDTLRRELQMAVVLITHDLGVVAQWADKVVVMYAGRKVEQALPGDLFN
DPLHPYTRGLLSASPRLKADFHYLRGPLNEIPGSIVSAAGEAGCPFRPRCDQARASCALQ
VPPLIAQTPDRLVACPFTSSLKAVPDAAHLSL