Protein Info for SMa2051 in Sinorhizobium meliloti 1021

Annotation: desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 76 to 101 (26 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 178 to 307 (130 residues), 73.8 bits, see alignment E=8.9e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa2051)

Predicted SEED Role

"possible desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XW9 at UniProt or InterPro

Protein Sequence (344 amino acids)

>SMa2051 desaturase (Sinorhizobium meliloti 1021)
MDDLKYGTRNKRGDWAPNQPVKTAPLFAFPPRLKAVLKWLPHYFFPWNMIFAASAVAYWA
WVIPPVERLQTLGIEWIAWLYVVNAISVFLFYGAFELHLYVFKRQENRFKYNGRFPADQK
SKAFWFESQNLDNILRTFLSGVTIWTAVEVAMLWAYANGYAPWLDFAENPWTLALIALVV
PIIHEFHFFCIHRLIHTPLLYKWVHSVHHNSVNPSPWSSLSMHPVEHLLYFGTAFYHLIL
PSNPVLMLYQLHYAGFGAIPGHVGFDKVEIGEDKLVDSHAYAHYLHHKYFEVNYGDTLIP
LDRWFGTWHDGSAEGEARMQERYRRRKEKLAVRKARVGIGEAAE