Protein Info for SMa1978 in Sinorhizobium meliloti 1021

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR01428: haloacid dehalogenase, type II" amino acids 9 to 203 (195 residues), 146.2 bits, see alignment E=1.8e-46 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 11 to 190 (180 residues), 43.6 bits, see alignment E=5.5e-15 PF00702: Hydrolase" amino acids 12 to 193 (182 residues), 65.4 bits, see alignment E=1.4e-21 PF13419: HAD_2" amino acids 99 to 199 (101 residues), 51.9 bits, see alignment E=1.6e-17 PF13242: Hydrolase_like" amino acids 155 to 218 (64 residues), 27.6 bits, see alignment E=3.4e-10

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to sme:SMa1978)

Predicted SEED Role

"HAD superfamily hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y02 at UniProt or InterPro

Protein Sequence (234 amino acids)

>SMa1978 hydrolase (Sinorhizobium meliloti 1021)
MIRSGQRPEWLTFDCYGTLIQWDEGLLAAMERILAGKNRSIERDAFISVYDRYEHRLERE
RPHRSFKNVSATALALAMGEFSLDVSPDDADILTSSISRMPPFPEVVATLTRLKAAGFKL
AIISNTDDAIIAGNVAQLGGSVDRVITAEQAGAYKPARQIFQHAWRELGIEKEQLVHICA
SPHLDLAAARELGFRTIWVDRGTGRKPLADYVPNETVARLDEVCGLLSAAGWME