Protein Info for SMa1959 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 320 to 346 (27 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 343 (306 residues), 97.4 bits, see alignment E=8.7e-32 PF00083: Sugar_tr" amino acids 61 to 200 (140 residues), 44 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1959)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y15 at UniProt or InterPro

Protein Sequence (412 amino acids)

>SMa1959 hypothetical protein (Sinorhizobium meliloti 1021)
MSICEIESTAIAPACDTTSGKRSKPGLSRSLTLLFAAASGLAVANAYFAHPLLDVIADDL
SLPRATIGFVVGATQLGYGLGLVLLVPVGDLVDRRNLVIIQSLLSVLALLCVGFAPTEEV
LFPALIAMGFFAVATQAFVAYAASLARPEERGAVVGTVTSGIVLGILLARTVAGAVVDIA
GWRAVYLLSAAFTLAITAILARVVPAQPKSGPAVSYPKLIGSLFTLFLQEPVLRVRAILA
FLIFADVTTLLTPLVLPLSAPPYSLSHAAIGLFGLAGAAGALGASRAGRWTDEGFGQRVT
GVALTLMLCSWILIGLLPYSILFLVTGVLLLDFGLQAVHVASQGLIYRVRPEAQSRLTAA
YMVFYSTGSALGSSISTLVYARWAWTGVSMLGAGIAAAALLFWAITLPKRMA