Protein Info for SMa1952 in Sinorhizobium meliloti 1021

Annotation: Beta lactamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF13354: Beta-lactamase2" amino acids 19 to 278 (260 residues), 158.7 bits, see alignment E=1.6e-50 PF00144: Beta-lactamase" amino acids 26 to 246 (221 residues), 92.8 bits, see alignment E=2.5e-30

Best Hits

Swiss-Prot: 52% identical to BLAC_PROMI: Beta-lactamase (blaP) from Proteus mirabilis

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_6300)

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y20 at UniProt or InterPro

Protein Sequence (281 amino acids)

>SMa1952 Beta lactamase (Sinorhizobium meliloti 1021)
MPALATVSTIARAELQHALEARLAELERRHGGRVGVAALNLSTGARVGHRADERFLMCST
FKALASAMVLARVDKGVEKLDRRIVFSKEVLVYFSPVTETRVGGEGMSVAELCMATLTQS
DNTAINLLLESFGGPPALTEFVRSFGDELTRLDRFEPELNEHDGPDDLRDTTTPGAMMET
LRKLIFGEVLSRSSRAQLAGWMVMNKTGDSRLRAGMPESWMIADKTGGNGNQHANNNDIA
VAWSPNRGAIVVATYCEIPTISADERNAVVAEVGRLVAELA