Protein Info for SMa1913 in Sinorhizobium meliloti 1021

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 53 to 81 (29 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 399 to 424 (26 residues), see Phobius details amino acids 434 to 457 (24 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 47 to 453 (407 residues), 423.5 bits, see alignment E=3.5e-131 TIGR00773: Na+/H+ antiporter NhaA" amino acids 48 to 452 (405 residues), 329.7 bits, see alignment E=1.2e-102

Best Hits

Swiss-Prot: 100% identical to NHAA_RHIME: Na(+)/H(+) antiporter NhaA (nhaA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 100% identity to sme:SMa1913)

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y37 at UniProt or InterPro

Protein Sequence (462 amino acids)

>SMa1913 Na+/H+ antiporter (Sinorhizobium meliloti 1021)
MWCRRRNSRWRHLPVAVKTAGVVHGMNDSLSRLPREPADRLTKPFMRFLRIEATAGIILL
LSTLLALGLANTAWSSSFLAFWEMPAGVRLGDIGIYRSLKHWINDGLMTFFFFVIALELK
RELVLGELRNPRMAALPVAAALGGMAAPAGIYLLLVGGGPGASGWGTVMSTDTAFVIGCL
ALLGSRVPGSLRLFLLSLAIFDDIGAILIVAVGYGEPLNWVALGTGGLGFAFVAGIALLG
IRSIPVYFAMGSAIWLAFDASGVHATLVGVILGLMTPARRWVSEIRLHAILDRVIAHPPG
DHRSRDTAARSDLHRAGVATREAVSPIERLEIALHPWVAFAIMPLFAVSNAGIPIEDANF
DVPLTIAIVVAFVVGKPAGIVLFSFLAVKLRLASRPEQLSWSLLAAGSLLTGIGFTMALF
IAELAFEPELLIPVKLGVLGASVISAALGFMALTLLTSPNRR