Protein Info for SMa1890 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF03061: 4HBT" amino acids 37 to 68 (32 residues), 22.3 bits, see alignment 2e-08 PF07992: Pyr_redox_2" amino acids 62 to 187 (126 residues), 67.3 bits, see alignment E=2.4e-22 PF00070: Pyr_redox" amino acids 63 to 131 (69 residues), 49.4 bits, see alignment E=8.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1890)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y49 at UniProt or InterPro

Protein Sequence (214 amino acids)

>SMa1890 oxidoreductase (Sinorhizobium meliloti 1021)
MRRPPMAETLPFTLLPPEESKVGLLATPEPRFCNLTNTVHGGWIMTMLDTVMALAAQTTL
SAGGGNTAVQEALYLSNLASKVTVVHRRDRFRAEPILQDRLPAKPNVEVIWNHVIDEVIG
EQEPRKSVTGIRIREVNTDDVKELTTHGLFVAIGHDPATALFRGQLDMDDAGYIKVGSWL
TKTTVPGGAGCRRCHRLGIPSGNHRCRHGKHGGP