Protein Info for SMa1862 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 239 to 265 (27 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 6 to 105 (100 residues), 46.9 bits, see alignment E=2.9e-16 PF00528: BPD_transp_1" amino acids 118 to 316 (199 residues), 116.8 bits, see alignment E=9.6e-38

Best Hits

Swiss-Prot: 32% identical to Y1050_BRUA2: Putative peptide transport system permease protein BAB2_1050 (BAB2_1050) from Brucella abortus (strain 2308)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to sme:SMa1862)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y63 at UniProt or InterPro

Protein Sequence (316 amino acids)

>SMa1862 ABC transporter permease (Sinorhizobium meliloti 1021)
MNNRVLSLVLSRLLIAVITLVIVSFAVFFATTLLPGDTASILLGQAATPEAVEGLRKAMH
LDEPAIFRFLRWIVGLLQGDLGTSYANEMPVKDLIGGRFVNTLQLAGVTALFSVPIALTL
GITSAMLRGSPYDRIVTVLTIGVISVPEFMIATSAVLVFAVYLKWLPALSFANEVTSMTD
LLRVYAMPVITLTFVISAQMIRMTRAAVIETLNTPYVEMALLKGASRSRMVFRHALPNAL
GPIVNAVALSLSYLLGGVIIVETIFNYPGIAKLMVDAVSTRDLPLIQSCAMVFCLGYLLL
ITTADIIAILSNPRLR