Protein Info for SMa1809 in Sinorhizobium meliloti 1021

Annotation: Non-heme haloperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF00561: Abhydrolase_1" amino acids 24 to 259 (236 residues), 104.9 bits, see alignment E=1.1e-33 PF12697: Abhydrolase_6" amino acids 25 to 265 (241 residues), 69.3 bits, see alignment E=1.6e-22 PF12146: Hydrolase_4" amino acids 25 to 124 (100 residues), 46.1 bits, see alignment E=7.9e-16 amino acids 207 to 259 (53 residues), 29.7 bits, see alignment E=8.3e-11 PF00326: Peptidase_S9" amino acids 185 to 273 (89 residues), 26.3 bits, see alignment E=9.8e-10

Best Hits

Swiss-Prot: 70% identical to THCF_RHOER: Non-heme haloperoxidase (thcF) from Rhodococcus erythropolis

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 100% identity to sme:SMa1809)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y90 at UniProt or InterPro

Protein Sequence (276 amino acids)

>SMa1809 Non-heme haloperoxidase (Sinorhizobium meliloti 1021)
MTQNFIKTEDDVEIFYKDWGSGQPIVFHHGWPLSSDDWDAQMLYFLGKGYRVIAHDRRGH
GRSTQVGDGHDMAHYAADVAALSTELDLRDAIHIGHSTGGGEALAYVARHGAGRVAKLVM
VGAVPPIMLKTEAYPGGLPIEVFDGLRVQLAANRAQFFLDLPSGPFYGFNRPGAQVSTGV
IQNWWRQGMMGSAKAHYDGIKAFSETDFTEDLKRVEVPVLVMHGDDDQIVPIDSSARLAV
KLLKNGTLKVYKGYPHGMLTTHADVINADLLEFIKA