Protein Info for SMa1760 in Sinorhizobium meliloti 1021

Annotation: phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF01636: APH" amino acids 106 to 341 (236 residues), 131.5 bits, see alignment E=2.2e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1760)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YB2 at UniProt or InterPro

Protein Sequence (415 amino acids)

>SMa1760 phosphotransferase (Sinorhizobium meliloti 1021)
MFQCCEIRHGTGPENGILRYLMHLLLRCFNYHVRQTVSAAMQPAPFANRRYATIEDKTEN
CANGTSMTEPTPATKKTDSMSATWNVTSLADAAAAVMRVYGAGGTVRRLSSERDETFLFT
RSDGRDFILKIANPAEDAAALEFQDGALLHLEAAAPVVPVPRLVRTKSGEQSHTLSTADG
PRVMRLLTFLRGELQYRTPASEAQSRNVGRALAALGLGLEDYRGRPPAGKLMWDISHTLD
LTAVVDHVAPERRAQAEAVLAEFERALPAITGLKRRQIIHNDFNPHNVLLDPSSPTTVVG
IIDFGDMVHAPLINDLAVALSYHLGTENWAARTGSFLEGFHSVRALEPGEIEVLPVLTRA
RLAMSLIIAEWRSARFPENRDYIMRNHATAWRGLQNISDLTPAGLKKLVPNLYEV