Protein Info for SMa1742 in Sinorhizobium meliloti 1021

Annotation: Fe3+-siderophore ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 251 to 277 (27 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details PF01032: FecCD" amino acids 33 to 338 (306 residues), 247.9 bits, see alignment E=6.5e-78

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to smk:Sinme_6158)

Predicted SEED Role

"ABC-type Fe3+-siderophore transport system, permease 2 component" in subsystem Flavohaemoglobin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YC4 at UniProt or InterPro

Protein Sequence (345 amino acids)

>SMa1742 Fe3+-siderophore ABC transporter permease (Sinorhizobium meliloti 1021)
MTAPSSTLAVVIAHRRKRARRHHAIIATLLTLVAVTFGVTLSIGQSITPPSDVLRVLLGE
PVPGASFTVGQLRLPRAVLSILAGLCFGLGGVAFQVMLRNPLASPDIIGITSGAGAAAVF
AIVVLSMTGPMVSVIAVVAGLGVALLVYALSFRNGVAGTRLILVGIGVSAMLQSVIAYIL
QSAPAWNLQEAMRWLTGSVNGAQLGQALPLLLALIFFGGLLLVRGRDLETLRLGDDTAAA
LGTRVSNTRMLVIVAAVGLIASATAASGPIAFVAFLSGPIAGRIVRNDGSVLIPSALTGA
VLVLAADYVGQHLLPSRYPVGVVTGALGAPYLLYLIVRINRIGGS