Protein Info for SMa1680 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 signal peptide" amino acids 43 to 43 (1 residues), see Phobius details transmembrane" amino acids 44 to 63 (20 residues), see Phobius details PF13435: Cytochrome_C554" amino acids 87 to 113 (27 residues), 16.6 bits, see alignment (E = 9.2e-06) amino acids 217 to 255 (39 residues), 17.3 bits, see alignment 5.4e-06 PF09699: Paired_CXXCH_1" amino acids 347 to 377 (31 residues), 25.8 bits, see alignment (E = 4.9e-09) PF13432: TPR_16" amino acids 588 to 642 (55 residues), 17.3 bits, see alignment 3.9e-06 amino acids 654 to 711 (58 residues), 31.2 bits, see alignment 1.7e-10 PF13181: TPR_8" amino acids 615 to 641 (27 residues), 14.9 bits, see alignment (E = 1.7e-05) amino acids 646 to 676 (31 residues), 16 bits, see alignment (E = 7.8e-06) PF14559: TPR_19" amino acids 620 to 680 (61 residues), 35.3 bits, see alignment 8.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1680)

Predicted SEED Role

"FIG00986931: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YF8 at UniProt or InterPro

Protein Sequence (797 amino acids)

>SMa1680 hypothetical protein (Sinorhizobium meliloti 1021)
MKPPRVSGRSLAEILGRAFWLSARDLPGWWMRAVRSCVCNSRAAVLWTVVFCSLAALTGS
VAASENSKTSMADPLIAVHDGFVDEKTCSSCHADEAAVFAKSHHAKAMTVADDKSVLGNF
NNIQFDRDGVAASFFRRDDRFFVRTEGSDGKQADYEVKYTFAYEPLQQYLVDLGGGRLQA
LDIAWDTQKREWFWLGEGSAAKPGSTFHWTGPFYRWNRTCIDCHSTDPRTNFKPQSNEYN
SSYVATSIGCQSCHGGGAKHVDWARTKAANASTAAADPGLAKVDSNTCFACHARRTRLVD
RYQPGGHFLDQFSPALLRSDLYFPDGQILDEVFEYGSFQQSKMAMAGVTCFDCHRPHEGT
VKAEGNGLCTQCHAETAPERFAGNDPSGAFDTQAHTHHPQGSPGALCANCHMPERTYMKV
DPRRDHSFVTPRPDLSALYGTPNACISCHTGQTNAWASEHLDRWYGKAWRERPTIAHAFA
RAAQNDVAAIENLRRFVTDREQPGIVRGSAIGEMTRLDGAATAADVRVAAGDPDPIVRLG
AAEAAANLSADRRLDAIGFLLADETRAVRVAAARVLGATPSLDLLGARRGAFDAALDDLG
AYAEANADVAETQSTYGSILFGQGRTDEAEKALRQAIILDPTLSGAHINLAEFYRASGDN
EKSEQAYAAAIAANPDRADLRYGHGLSLVRLKALPDAIEELTAAMRLDPGNSHYRTTAAI
ALDSMGRTDDAFALFGPTIAGGATEANLLGTAIQLGLKLGRYAETLKFAEALARLQPNDP
QLEELVGQLQDAVQHGR