Protein Info for SMa1670 in Sinorhizobium meliloti 1021

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR01078: arginine deiminase" amino acids 13 to 417 (405 residues), 492.3 bits, see alignment E=4.8e-152 PF02274: ADI" amino acids 41 to 414 (374 residues), 441.1 bits, see alignment E=3.6e-136

Best Hits

Swiss-Prot: 100% identical to ARCA2_RHIME: Arginine deiminase 2 (arcA2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 100% identity to smk:Sinme_6104)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.6

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YG5 at UniProt or InterPro

Protein Sequence (419 amino acids)

>SMa1670 arginine deiminase (Sinorhizobium meliloti 1021)
MSSKSSTQHTFGVHSEVGQLRKVMVCAPGRAHQRLTPSNCDALLFDDVLWVDNARRDHFD
FMTKMRDRGVEVVEMHNLLAQTVAIPEARKWILDNQVVPNQVGLELLDEIRSYLEGLPDR
ELAETLIGGLSTHEFPETHGGEMLELIRDAAGVAEYLLPPLPNTLYTRDTTCWIYGGVTL
NPLYWPARHEETILATAIYKFHPDFVGKVNVWWGEPTTDWGLATLEGGDVMPIGKGNVLI
GMSERTSRQAISQLAATLFEKGAAQRVIVAAMPKLRAAMHLDTVFTFADRDCVLIYPDIV
NEIEAFSYRPGEKPGSLELHKDRGSFVETVRDALGLKEMRVVETGGNAYVRERTQWDSGA
NLVCLSPGVVLAYDRNTYTNTLLRKAGVEVITITGAELGRGRGGGHCMTCPIIRDAVDY