Protein Info for SMa1664 in Sinorhizobium meliloti 1021

Annotation: HlyD-family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 34 to 366 (333 residues), 264.6 bits, see alignment E=5.4e-83 PF25917: BSH_RND" amino acids 58 to 191 (134 residues), 53 bits, see alignment E=5e-18 PF25876: HH_MFP_RND" amino acids 99 to 167 (69 residues), 25.2 bits, see alignment E=3.2e-09 PF25944: Beta-barrel_RND" amino acids 203 to 290 (88 residues), 46.2 bits, see alignment E=1e-15 PF25967: RND-MFP_C" amino acids 299 to 357 (59 residues), 46.2 bits, see alignment E=6.9e-16

Best Hits

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to smk:Sinme_6100)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YG9 at UniProt or InterPro

Protein Sequence (388 amino acids)

>SMa1664 HlyD-family protein (Sinorhizobium meliloti 1021)
MFKTAFRSVDFVLGVSGLLLCSAGDGVAQTGPVVGVMTVQVENVSPAHEFVGRVEALNAV
DIRARVEGFLERRLFAEGQNVEKGQDLFTLERTTYELALEDAQATLVGAQTNFDNAERQL
QRNRALSQRTVSQAVIEESHAARDIARASVLSAQTRVNQAELNLGYTHIKAPIDGRIGRA
AYSVGSLVSPSSEPLARVVQTDPIRVVFSVSDRTILDLRTIAGGAGKDELAKGYALKLRL
SNGEPYQQSGKLEFFGNEIDVQTGTLPIRALFANAQSLLMPGQFVTVIVEPEEREERPVV
PVGSVEQDREGRFVLVVDGESRAAVRRIRASVQVGQNWVVEEGLQGGEKLIVEGLQRVSP
GAVVEAQSVSAGDAATDTAAPAPRLSSQ