Protein Info for SMa1644 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details PF03824: NicO" amino acids 33 to 111 (79 residues), 34 bits, see alignment E=2.1e-12 PF13386: DsbD_2" amino acids 63 to 214 (152 residues), 26.1 bits, see alignment E=7.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_6088)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YI2 at UniProt or InterPro

Protein Sequence (239 amino acids)

>SMa1644 ABC transporter permease (Sinorhizobium meliloti 1021)
MPQAIVDIQRDIYLALAEHIKTIANGGGWTDFLTFLPMGIIFGAVHAMTPGHSKAVLATY
LTGASAGMRRGLVVSLALSATHVTMAVVIALFSLPLVSLMLGSAGSAPLLEDVSRGLLGL
IGAWMLWSVCFRPPHVHGEGEGVAVGFMAGLIPCPLTLFVMTFAISRGVPGAGIMFALVM
MTGVAITLSSVALVTVFFRTRMEKLLATRHALLVKISKFVEAFTGLILVVIAMREIFIR