Protein Info for SMa1637 in Sinorhizobium meliloti 1021

Annotation: transposase TRm17b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF01609: DDE_Tnp_1" amino acids 27 to 159 (133 residues), 53.2 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: K07481, transposase, IS5 family (inferred from 100% identity to sme:SMa1637)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YI7 at UniProt or InterPro

Protein Sequence (168 amino acids)

>SMa1637 transposase TRm17b (Sinorhizobium meliloti 1021)
MSACSNRHADIIVKGSRDVDYGHKLNLTTGRSGLILDLVIEAGNPADSERLLPLLERHIA
FYGEAPRQAAADGGYASRENLRQAKAWGVRDMAFHKKSGLRIEDMVRSRWVYRKLRNFRA
GIEAGISCLKRTYGLARCTWRGLDHFKTYVWSSVVAYNLALFARLRPT