Protein Info for SMa1586 in Sinorhizobium meliloti 1021

Annotation: SyrB2 regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF01527: HTH_Tnp_1" amino acids 51 to 134 (84 residues), 43.2 bits, see alignment E=1.9e-15

Best Hits

Swiss-Prot: 100% identical to SYRB2_RHIME: Probable transcriptional regulator syrB2 (syrB2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_6058)

Predicted SEED Role

"SyrB2 transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9Z3Q1 at UniProt or InterPro

Protein Sequence (151 amino acids)

>SMa1586 SyrB2 regulator (Sinorhizobium meliloti 1021)
MADESNTGSIAAAVAPNADVKAPAAKKKRSPRRQKAVAEPRRAVSETPAAKPRRYSEQQR
KEKLKLIETQVTEGKVTLKDAIKSAGISEQTYYQWKRTVKPVEQKAEKRLPTGEELADLV
RLEEENQRLRKLLAEKLRAENADLRKRLGLD