Protein Info for SMa1576 in Sinorhizobium meliloti 1021

Annotation: CpaB2 pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03177: Flp pilus assembly protein CpaB" amino acids 4 to 231 (228 residues), 220.3 bits, see alignment E=1.4e-69 PF08666: SAF" amino acids 42 to 107 (66 residues), 24.1 bits, see alignment E=4.3e-09 PF16976: RcpC" amino acids 114 to 222 (109 residues), 105.5 bits, see alignment E=1.5e-34

Best Hits

KEGG orthology group: K02279, pilus assembly protein CpaB (inferred from 99% identity to smk:Sinme_6051)

Predicted SEED Role

"Flp pilus assembly protein RcpC/CpaB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YL7 at UniProt or InterPro

Protein Sequence (263 amino acids)

>SMa1576 CpaB2 pilus assembly protein (Sinorhizobium meliloti 1021)
MIRIVILLLALASGGAASWLALGTGDQRAVEVAEVQETPSQEVLVAAAELKRGAVIEENQ
LRWQPWEGEIPPVFISRSSRPDATTALKGSLALSGFVAGEPIRDDKLAQGGTGYLSSLLP
SGKRAIAVRVTAESTAGGFILPNDHVDVIHTVARPDASGDAGKVVSRAILSNIRVLAVDQ
TVSQASDGASVIGKTATLEVDPEQISAVAAAEASGTVSLALRAITDNHEASVVEAEGTRP
GVVRFFNGGRMSMVEVPSRSGGS