Protein Info for SMa1568 in Sinorhizobium meliloti 1021

Annotation: CpaF2 pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF00437: T2SSE" amino acids 139 to 413 (275 residues), 212.9 bits, see alignment E=2.8e-67

Best Hits

KEGG orthology group: K02283, pilus assembly protein CpaF (inferred from 100% identity to sme:SMa1568)

Predicted SEED Role

"Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YM1 at UniProt or InterPro

Protein Sequence (497 amino acids)

>SMa1568 CpaF2 pilus assembly protein (Sinorhizobium meliloti 1021)
MPSAFAFNELKLLNLGNRATTMFGKKSISEERTAEAAVQPVVENELQAAHAPVQVRKPPQ
VPATAKPENAEQYYSLKKEIFSALIATIDVAALSNMDGEQARNEIGAIINDIVAAKKAGI
SMAEQNDLLSDICNDILGYGPLEPLLARDDIADIMVNGANQVFIEVNGRVQETGIRFRDN
EQLLNICQRIVSQVGRRVDESSPICDARLGDGSRVNVIAPPLAIDGPTLTIRKFKKEKLT
LDQLVRFGSISPEGAEVLKIIGRVRCNVLISGGTGSGKTTLLNCLTGYIDHGERVITCED
AAELQLQQPHVVRLETRPPNIEGQGEITMRNLVKNCLRMRPERIIVGEVRGPEAFDLLQA
MNTGHDGSMGTLHANSPREAMARIEAMITMGGSSLPAKTIREMLVSSVDVIVQAARLRDG
SRRITHITEVLGMEGEVVTTQDLFVYDILGEDEKGNIIGRHRSTGIGRPAFWDRARYYGE
EARLAAALDAAELKAAA