Protein Info for SMa1564 in Sinorhizobium meliloti 1021

Annotation: Pilus assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 299 to 324 (26 residues), see Phobius details PF00482: T2SSF" amino acids 167 to 290 (124 residues), 69.1 bits, see alignment E=1.7e-23

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 100% identity to smk:Sinme_6046)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YM2 at UniProt or InterPro

Protein Sequence (333 amino acids)

>SMa1564 Pilus assembly protein (Sinorhizobium meliloti 1021)
MATSLLFPVFVFLLASTSIGGMMVAAFYPRVSKASAYRQRFERISARAEDKRSEPAETDG
RDRRRSVEKTLREIEEKRQANARKGKVTLSARLRQSGLHWSRKAYFLVCAGATLATWVVM
LLLLGLGPLVSVGFAIAGGLLLPHLYVNMKRNARFTRFAAEFPNAVDVIVRGLKAGLPMP
DCLRVIAMEAQEPVKGEFLAIVQDQTLGIPVDEAVKRMSERMPLAEANFFAIVVAIQSRT
GGSLSEALGNLSKVLRERKKMKGKIKAMSSEAKSSAGIIGALPFLVAGAVYFMSPDYMAL
LFTTMIGKVVVVGCGLWMGIGILVMRKMINFDF