Protein Info for SMa1547 in Sinorhizobium meliloti 1021

Annotation: protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 35 to 217 (183 residues), 186.4 bits, see alignment E=3.2e-59 PF01135: PCMT" amino acids 36 to 218 (183 residues), 189.9 bits, see alignment E=2.6e-60

Best Hits

Swiss-Prot: 54% identical to PIMT1_POLSJ: Protein-L-isoaspartate O-methyltransferase 1 (pcm1) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to sme:SMa1547)

MetaCyc: 48% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YN1 at UniProt or InterPro

Protein Sequence (223 amino acids)

>SMa1547 protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (Sinorhizobium meliloti 1021)
MKPMNEEHLAVLRRHMVEVVAIYADLASEELGKAALDERVMAAMLRVPRHLFVPAQAAPF
AYQDMPLPIGFDKTVSQPFMVALMTDLLAPKPHEAVLEIGTGLGYQTAILAQLAGKIWSV
EIIEEFASHAEALLHGLGMSNVGIRIGDGSRGWPEHAPFDKILVTAAAEEPPPALLEQLK
PMGRLVLPVGSEEQVLTVIDKDSEGQFLARQLIPVRFSKLEAV