Protein Info for SMa1532 in Sinorhizobium meliloti 1021

Annotation: NADH dehydrogenase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 12 to 152 (141 residues), 241.7 bits, see alignment E=1.1e-76 PF01058: Oxidored_q6" amino acids 38 to 144 (107 residues), 100.7 bits, see alignment E=2.6e-33

Best Hits

Swiss-Prot: 100% identical to NUOB2_RHIME: NADH-quinone oxidoreductase subunit B 2 (nuoB2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to sme:SMa1532)

MetaCyc: 59% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P56897 at UniProt or InterPro

Protein Sequence (167 amino acids)

>SMa1532 NADH dehydrogenase subunit B (Sinorhizobium meliloti 1021)
MAGVNDAIRDSVLFTTADSIISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVF
RPSPRQSDVMIIAGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYNTYAVVQGSE
TFVPVDVHVPGCPPRPEALMHGFLLLQEKIKKSRALTGTPLGRVIAS