Protein Info for SMa1526 in Sinorhizobium meliloti 1021

Annotation: NuoE2 NADH I chain E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 TIGR01958: NADH-quinone oxidoreductase, E subunit" amino acids 6 to 150 (145 residues), 206.9 bits, see alignment E=7.5e-66 PF01257: 2Fe-2S_thioredx" amino acids 8 to 150 (143 residues), 179.8 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 100% identical to NUOE2_RHIME: NADH-quinone oxidoreductase subunit E 2 (nuoE2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 100% identity to smk:Sinme_6025)

MetaCyc: 32% identical to hydrogenase gamma subunit (Thermotoga maritima)
RXN-12215 [EC: 1.12.1.4]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.12.1.4 or 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P56910 at UniProt or InterPro

Protein Sequence (168 amino acids)

>SMa1526 NuoE2 NADH I chain E (Sinorhizobium meliloti 1021)
MTMREEIEAAAARYPDRRSAIMPALMIAQKEHGHLPGPVLEEVAQILGVERVWVYELATF
YTLFHTEPIGRFHLQLCDNVSCMLCGSEALLTHLETTLGIRKGETTPDGAFTLSTVECLG
ACEMAPVMQVGDDYHGNLDAARLDALLESFRAAERVTSVERAAAAPGE