Protein Info for SMa1514 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 259 to 284 (26 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 280 (271 residues), 114.2 bits, see alignment E=3.1e-37

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_6018)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YP0 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SMa1514 ABC transporter permease (Sinorhizobium meliloti 1021)
MDLFIAIFTGTIIAATPLIFAALGELVVEKSGVLNLGLEGMMLMGAAFAFWAVIAGLPMP
VAIAAGALAGAATSLLFGVLALTFLTNQYAAGLALAIFGSGVSAFLGRGFGSAPIDALKR
VHIPFLSDIPVVGPMFFRFDPMVYLAIGMFGLITWFLYRTKGGLILRTIGESPETSHAIG
YPVIRIRYLAVLFGGLMAGLAGAYLSVAYTPLWVENMTAGKGWISLALVVFATWRPLRVL
IGAWLFGGMTILQLQGQALGIAVPSELLSALPYLATIIVLVIISQNRQLLTLHFPASLAK
PFRAAS