Protein Info for SMa1491 in Sinorhizobium meliloti 1021

Annotation: Oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00111: Fer2" amino acids 4 to 57 (54 residues), 37.5 bits, see alignment E=2.8e-13 PF01799: Fer2_2" amino acids 71 to 143 (73 residues), 82.2 bits, see alignment E=3.7e-27

Best Hits

Swiss-Prot: 51% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 100% identity to smk:Sinme_6006)

MetaCyc: 70% identical to 2-deoxy-D-ribose dehydrogenase alpha subunit (Pseudomonas simiae)
1.1.2.M2 [EC: 1.1.2.M2]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.1.2.M2 or 1.3.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YQ2 at UniProt or InterPro

Protein Sequence (154 amino acids)

>SMa1491 Oxidoreductase (Sinorhizobium meliloti 1021)
MELTINGSRHQVDIEPDTPLLWVLRDELGMTGTKYGCGLAQCGACTVLVDGQATRSCVTP
VESVAGSEIMTIEAITEDPVGQKVVEAWVSNQVPQCGYCQSGQVMAATALIKQSPRPSDE
DIAGAMINLCRCGTYNAIAAAVRQAAEARSGATP