Protein Info for SMa1461 in Sinorhizobium meliloti 1021

Annotation: muconate cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 7 to 128 (122 residues), 65 bits, E=7.4e-22
• PF13378: MR_MLE_C
  • amino acids 150 to 361 (212 residues), 165.3 bits, E=1.8e-52

Best Hits

KEGG orthology group: K01856, muconate cycloisomerase [EC: 5.5.1.1] (inferred from 100% identity to sme:SMa1461)

Predicted SEED Role

"mandelate racemase/muconate lactonizing enzyme family protein" in subsystem Catechol branch of beta-ketoadipate pathway

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• superpathway of salicylate degradation (5/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (4/6 steps found)
• catechol degradation to β-ketoadipate (2/4 steps found)
• mandelate degradation to acetyl-CoA (5/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.1

Sequence Analysis Tools

See Q92YR6 at UniProt or InterPro

Protein Sequence (374 amino acids)

>SMa1461 muconate cycloisomerase (Sinorhizobium meliloti 1021)
MVKISNVRVRPLVLPLKQPYHWSYGIRESFAVNLIEIEADDGTVGIGECTVAPDQTGTAA
ILYRLAKHLVGHSPHDVAPLIARIFHQEYLGHGANIMRAANQIFSGIDMAMWDLQGKLAG
LPVHQLLGGAHRKAVGYFYFLQGETAEELARDAAVGHAQGERVFYLKVGRGEKLDLEITA
AVRGEIGDARLRLDANEGWSVHDAINMCRKLEKYDIEFIEQPTVSWSIPAMAHVREKVGI
PIVADQAAFTLYDVYEICRQRAADMICIGPREIGGIQPMMKAAAVAEAAGLKICIHSSFT
TGITTCAEHHIGLAIPNLDDGNQIMWQLVQEDIVSSPDLTPKNGWLDAFRKPGLGFQLAE
DLVAEGEGRYAASR