Protein Info for SMa1428 in Sinorhizobium meliloti 1021

Annotation: TetR/AcrR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00440: TetR_N" amino acids 27 to 71 (45 residues), 45.9 bits, see alignment 4e-16 PF17938: TetR_C_29" amino acids 95 to 213 (119 residues), 144.9 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 41% identical to NICS_PSEPK: HTH-type transcriptional repressor NicS (nicS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5973)

Predicted SEED Role

"transcriptional regulator, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YT3 at UniProt or InterPro

Protein Sequence (219 amino acids)

>SMa1428 TetR/AcrR family transcriptional regulator (Sinorhizobium meliloti 1021)
MRTTSAQKAKSAGKPRLRDAEATKARILEAAKKEFAKNGLGGARVDVIAEKANANKRMIY
HYFDGKDHLFQTVLEDAYNGIRTAEQKLNLNDLEPKAALEKLVRFTWEYYLKHPEFITLV
NSENLHRAKHLKKSQVVRATSRKFVGMVKELLERGVSEGVFRPGIDPVQLNLTIAAIGYY
YITNRFTGSIVFERDLMAKDALEERVQFNIETIMRMVCA