Protein Info for SMa1368 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details PF01925: TauE" amino acids 13 to 234 (222 residues), 78.4 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to sme:SMa1368)

Predicted SEED Role

"FIG01074627: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YW3 at UniProt or InterPro

Protein Sequence (241 amino acids)

>SMa1368 hypothetical protein (Sinorhizobium meliloti 1021)
MELLISPQGIAAAVALILAGAVQGSTGFGFNMLAAPMLAIIDPAFVPGPMLAMAIAVSAG
GTVREWSDVNRQDLAFSLTGRLLAAGAAAFCLQLLSPDAFAAVFGFGVLFAVALSLAGLR
IDTTRSSLFLAGVLSGFMGTLTSIGAPPMAMVYQNTGGARMRATLNAFFVVGGIISIGAL
FVAGSFGLSDLLLAATMLPFAFLGFLLSGWGRRLVDRGHVKVIVLIVSAASALVLLLRAF
S