Protein Info for SMa1347 in Sinorhizobium meliloti 1021

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 6 to 308 (303 residues), 64.2 bits, E=1.5e-21
• PF02826: 2-Hacid_dh_C
  • amino acids 104 to 279 (176 residues), 188 bits, E=1.5e-59
• PF03807: F420_oxidored
  • amino acids 143 to 225 (83 residues), 24.9 bits, E=3.8e-09

Best Hits

KEGG orthology group: K00058, D-3-phosphoglycerate dehydrogenase [EC: 1.1.1.95] (inferred from 100% identity to sme:SMa1347)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

See Q92YX6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>SMa1347 dehydrogenase (Sinorhizobium meliloti 1021)
MSFIFSTHRLHPDAEAMLKAASDLRVASAPDPETLLREGEGAEIVIVRAPIPPAFFGNVP
ALRAVVRHGAGLDMIPYDAATAAGVLIANVPAVNAPTVAEHVFMVTLALLRQFRPMDRDL
RNMGWSTGRAHSDRALDLAGRIMGVIGMGNVGKAVFRIAKYGFQLEIVANSRSPESLPDG
VRFLSVDDLLSTADIVVLCCPLTPKTTGLLSRERIARMKPGAILVNVSRGPVVDDAALIE
ALERGRIGGAALDVFSTQPLPPEHPYFRQDNVIVTPHLAGISEESMMRMGKGAAAEAIRV
MEGGLPVNLRNPEVVEHYRRRFPG