Protein Info for SMa1341 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 129 to 312 (184 residues), 71.2 bits, see alignment E=4.7e-24

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_5921)

Predicted SEED Role

"Dihydroxyacetone ABC transport system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YX9 at UniProt or InterPro

Protein Sequence (319 amino acids)

>SMa1341 ABC transporter permease (Sinorhizobium meliloti 1021)
MAAVQTRSERALNRVAIAAVLVITLLFLAPIYWITSTAFKPRNLATTIPPTVIFEPEISP
FVKLFTKRSQLRSAPEPEDYAAAPWWERLVFDGGEKVVRSGRGQVQLSGYPNRFMNSLIV
AITSTVLAVAMGTFTAYGFSRFKVKGEADLLFFILSTRMLPPVVVAIPMFLMYRAVGLND
THWGLIILYTAFNLSFSVWLMKGFIDEIPKEYEEAALVDGYTRLEAFFKIVLPEAATGIA
ATAVFCFITAWNEYAFALIMTNRRAQTAPPFIPSQVGSGLPDWTVIAAGTFLFLLPVAIF
TFLLRNHLLRGMSFGAIRK