Protein Info for SMa1315 in Sinorhizobium meliloti 1021

Annotation: VirB4 type IV secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 792 TIGR00929: type IV secretion/conjugal transfer ATPase, VirB4 family" amino acids 12 to 788 (777 residues), 815.4 bits, see alignment E=2.7e-249 PF27097: VirB4_TrbE_N" amino acids 28 to 128 (101 residues), 107 bits, see alignment E=9.6e-35 PF03135: CagE_TrbE_VirB" amino acids 179 to 380 (202 residues), 172.4 bits, see alignment E=2.5e-54 PF19044: P-loop_TraG" amino acids 622 to 701 (80 residues), 35.6 bits, see alignment E=9.1e-13

Best Hits

Swiss-Prot: 62% identical to VIRB4_BARHE: Type IV secretion system protein virB4 (virB4) from Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1)

KEGG orthology group: K03199, type IV secretion system protein VirB4 (inferred from 100% identity to sme:SMa1315)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YZ6 at UniProt or InterPro

Protein Sequence (792 amino acids)

>SMa1315 VirB4 type IV secretion protein (Sinorhizobium meliloti 1021)
MPSLTTLRSRELGPETFIPYVRHVDESTIALDSRALMVMIALEGVSFETADILDLNALHR
DLNTLYRNIADERLALWTHLIRRRDNSYPEGTFATPFSAALNDKYRERMVGEDLFRNDLY
LSILWSPARDPADKAAKLLSRLRRARRVGTELDEGALKHLRDKVIDVTAALRRFEPRVLT
LYEHDGLMFSEPSEVLHQLVGGRREPIPLTEGHIASAIYSDRVIVGRETIEIRHEADSRY
AGMLSFKEYPARTRTGMLDAVLTSPFELILAQSFSFVSKADARMIMGRKQNQMVSSGDKA
ASQIEELDGAMDDLESNRFVFGEHHLTLSVFAPSVKELTDNLAKARASMTSGGAVVARED
LGLEAAWWAQLPGNFRYRARSGAITSRNFAALSPFHSYPLGQKDGNEWGPAVALLKTASG
SPYYFNFHYGDLGNTFVCGPSGAGKTVLLNFMLSQLEKHDPHVVFFDKDRGADLYVRAAG
GTYLPLKNGIPTGCTPLKALELTPENKVFLTRWVGKLVGSATRELSVTELRDISSAIDGL
ADLPVERRTIGALRTFLDNTNPEGIAARLRRWERGGPLGWVFDNVIEDIGFGEFGGGKLV
GYDMTDFLDNEEIRAPLMAYLFHRVEQLIDGRRIIIVIDEFWKALQDEGFRDLAQNKLKT
IRKQNGLMLFATQSPRDAIVSPIAHTIIEQCPTQIFLPNSRGNHGDYVDGFKLTEREFEL
VARELSIESRRFVLKQGHNSVVAELDLKGLDDELAILSGRTANVELADAIRAEVGSNAKD
WLPVFQQRRSAT