Protein Info for SMa1288 in Sinorhizobium meliloti 1021

Annotation: Carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 2 to 447 (446 residues), 445.5 bits, E=8.8e-138
• PF20695: UbiD_N
  • amino acids 2 to 72 (71 residues), 70.9 bits, E=1.2e-23
• PF01977: UbiD
  • amino acids 115 to 314 (200 residues), 254.6 bits, E=7.4e-80
• PF20696: UbiD_C
  • amino acids 321 to 444 (124 residues), 153.7 bits, E=3.8e-49

Best Hits

Swiss-Prot: 54% identical to UBID_SACD2: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to sme:SMa1288)

MetaCyc: 54% identical to 4-hydroxy-3-polyprenylbenzoate decarboxylase (Cereibacter sphaeroides)
RXN-9231 [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• ubiquinol-10 biosynthesis (early decarboxylation) (5/8 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Sequence Analysis Tools

See Q92Z11 at UniProt or InterPro

Protein Sequence (483 amino acids)

>SMa1288 Carboxylase (Sinorhizobium meliloti 1021)
MLERRGRLLRISRPVSLVHEVTEIHRRVLLAGGPALLFERPVDASGRVCDIPLLANLFGT
LERIEWGFGLPAGGLPGLAEMLAELREPRSPQSLSDAWGKLPLLKAALAMRPRNVSSPPV
QDTVWRGAEADLSRLPIQWCWPGEPAPLVTWPLVITRAPDDPSDVNVGIYRMQVLGPNRL
VLRWLAHRGGARHHRMWQQRREDMPVAVAIGSDPATILAAVMPLPESMNELAFAGLLKAE
RQPVAQAVTVPLSVPANAEIVLEGVVSADETAEEGPYGDHTGYYNSVERFPVMSLSAITM
RHRPFYLSTFTGRPPDEPSKLGEAMMELFLPLVKRQFPEIIDLYLPPEACSYRAMVVSID
KRYPGQAKRIMMGLWSMLPQFNYTKLIVAVDPDIHVRNWSDVIWALSTRFDASRDVTILN
DTPIDYLDFASPKPGLGGKLGLDATRKVGPETNREWGRVLEMPAEVVGKIDQFWAELGLG
EAP