Protein Info for SMa1276 in Sinorhizobium meliloti 1021

Annotation: NorC nitric oxide reductase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF00034: Cytochrom_C" amino acids 50 to 136 (87 residues), 49.9 bits, see alignment E=6.9e-17 PF13442: Cytochrome_CBB3" amino acids 50 to 133 (84 residues), 29 bits, see alignment E=1.1e-10

Best Hits

Swiss-Prot: 66% identical to NORC_PARDE: Nitric oxide reductase subunit C (norC) from Paracoccus denitrificans

KEGG orthology group: K02305, nitric oxide reductase, cytochrome c-containing subunit II (inferred from 100% identity to sme:SMa1276)

MetaCyc: 69% identical to nitric oxide reductase cytochrome c subunit (Nitrosomonas europaea)
NITRIC-OXIDE-REDUCTASE-RXN [EC: 1.7.2.5]

Predicted SEED Role

"Nitric-oxide reductase subunit C (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.5, 1.7.99.7

Use Curated BLAST to search for 1.7.2.5 or 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z15 at UniProt or InterPro

Protein Sequence (150 amino acids)

>SMa1276 NorC nitric oxide reductase, small subunit (Sinorhizobium meliloti 1021)
MAERLTKTGARNVFYGGSIFFFAIFVGLTAHSHYYMKTESTDETTLTDSVARGKHVWEKN
SCINCHTLLGEGAYFAPELGNVWKRWGGESDPEGARETLKSWMAAQPSGAEGRRQMPQFK
LTEQELNDLADFLEWTSRIKTQNWPPNEAG