Protein Info for SMa1259 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 74 (29 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 377 to 394 (18 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1259)

Predicted SEED Role

"Protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z23 at UniProt or InterPro

Protein Sequence (452 amino acids)

>SMa1259 hypothetical protein (Sinorhizobium meliloti 1021)
MPGATLSPWTMSYFAAACLFLVVGQCAMVAGYGYPFAAVESPATLALVHVVAIGWLGLLM
TGALLQFVPVLVAAPLRAGRLALPALALLIPGLLLLVGGFAALGGAEGVSPAMLPSGALL
LAMGFGLVIIMLATTLLTVRPLPLPARFVAVGLGALIAAVLVGGAFTLVLSGTVTNYAAI
GLLLKGVPLHATLGLGGWLTFSAIGVSYRLLPMFMLARDDMWPTSRAVWWAGAAALAIVA
ARIVSIAVDSDGMEGAESVAAFLAVLAAVLYSADVLRLFRERRRKLVELNVRASYAAFAA
LFASVVMSALPTTRAAAGEGAAALVYLFVFGWLTGLGLAQLYKIVPFLTWLECYGPVLGR
VPVPRVQDLVEEKRARLWFFVYYLAVIAATLSLFAQSPAAFRVAVLAQLCATVGLMVELV
RARMLSSVATPLRLPAGAPRPHLFLPISRPQE