Protein Info for SMa1252 in Sinorhizobium meliloti 1021

Annotation: NnrS family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 279 to 304 (26 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details PF05940: NnrS" amino acids 24 to 399 (376 residues), 379.8 bits, see alignment E=9e-118

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to sme:SMa1252)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z28 at UniProt or InterPro

Protein Sequence (403 amino acids)

>SMa1252 NnrS family protein (Sinorhizobium meliloti 1021)
MSGSKVAKREGYVPRGFARTGPVLFSYGFRPFFLGAAVWAVVAMTLWIAALVGHLEVAGS
YGAHAWHAHEMLFGFAPAVLAGFLLTAVPNWTGRLPVSGWPLAGLFTLWLAGRAALLSPD
VIGIPPAAAIDGLFLPALLLICAREVIAGRKWKDLKVLGGLLALSLANACFHFAVVTGDH
VHIAMRLGISAYVALVTIIGGRILPSFTRNWLNRAGRTEFPVPYNHFDTVAILAGIAALG
AWTLAPDHPVTAVPAFAAALLHTVRLARWRGWRTWPEMLLVILHVAYAFVPLGFAATGIG
ALGFVEELSVMHVLTVGAIAAMMLAVMTRASRGHTGYPLTASRLTAASYAAVVLSALLRP
LAEMLPEIAPTLYAVSGSAWILAFALFCIEYGPILVRKRRAVQ