Protein Info for SMa1240 in Sinorhizobium meliloti 1021

Annotation: NapF ferredoxin component of periplasmic nitrate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF00037: Fer4" amino acids 35 to 53 (19 residues), 28.7 bits, see alignment (E = 5.7e-10) amino acids 133 to 154 (22 residues), 33.7 bits, see alignment (E = 1.6e-11) PF13237: Fer4_10" amino acids 35 to 79 (45 residues), 35.7 bits, see alignment E=4.5e-12 PF12800: Fer4_4" amino acids 35 to 49 (15 residues), 20.9 bits, see alignment (E = 2.4e-07) amino acids 106 to 117 (12 residues), 12.3 bits, see alignment (E = 0.00014) amino acids 137 to 151 (15 residues), 19.9 bits, see alignment (E = 5.1e-07) PF13187: Fer4_9" amino acids 36 to 80 (45 residues), 35.3 bits, see alignment E=6.9e-12 amino acids 106 to 154 (49 residues), 33.9 bits, see alignment E=1.8e-11 PF12838: Fer4_7" amino acids 37 to 80 (44 residues), 36.6 bits, see alignment E=3.6e-12 amino acids 106 to 153 (48 residues), 42.2 bits, see alignment E=6.5e-14 PF12798: Fer4_3" amino acids 37 to 50 (14 residues), 17.9 bits, see alignment (E = 3.1e-06) amino acids 139 to 153 (15 residues), 18.9 bits, see alignment (E = 1.5e-06) PF25160: LdpA_Fe-S-bd" amino acids 107 to 155 (49 residues), 32.4 bits, see alignment E=4.4e-11 PF12797: Fer4_2" amino acids 132 to 151 (20 residues), 26.9 bits, see alignment (E = 2.2e-09) PF12837: Fer4_6" amino acids 135 to 154 (20 residues), 27.8 bits, see alignment (E = 1.2e-09)

Best Hits

KEGG orthology group: K02572, ferredoxin-type protein NapF (inferred from 100% identity to sme:SMa1240)

Predicted SEED Role

"Ferredoxin-type protein NapF (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z34 at UniProt or InterPro

Protein Sequence (166 amino acids)

>SMa1240 NapF ferredoxin component of periplasmic nitrate reductase (Sinorhizobium meliloti 1021)
MGEGIEISRRSFLRGRHKRGSGRVSPPGATAEGLEACTGCGRCADACPTHIIRVIDDRPA
LDFFIAECTFCGQCAELCPEPVFTGRSQQFPHVAMIGESCLARNRTDCQACRDACPTEAI
RFRPRAGGPFLPELNEELCTGCGACLSVCPVAAIGIREVEWERAHV