Protein Info for SMa1232 in Sinorhizobium meliloti 1021

Annotation: NapC membrane-bound tetraheme cytochrome c subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details TIGR02161: periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family" amino acids 9 to 193 (185 residues), 318.8 bits, see alignment E=5.7e-100 PF03264: Cytochrom_NNT" amino acids 19 to 192 (174 residues), 257.2 bits, see alignment E=1.8e-80 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 52 to 187 (136 residues), 34.1 bits, see alignment E=4.9e-12

Best Hits

Swiss-Prot: 77% identical to NAPC_PARPN: Cytochrome c-type protein NapC (napC) from Paracoccus pantotrophus

KEGG orthology group: K02569, cytochrome c-type protein NapC (inferred from 99% identity to smk:Sinme_5889)

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Z38 at UniProt or InterPro

Protein Sequence (233 amino acids)

>SMa1232 NapC membrane-bound tetraheme cytochrome c subunit (Sinorhizobium meliloti 1021)
MAGIKRLLLWVWKILTTPAATLSLAFLTLGGFVGGVIFWGAFNTALELTNTEEFCVSCHE
MRANVYEELTRTIHFSNRSGVRASCPDCHVPHEWTDKIARKMQASKEVWGKIFGTINTRE
KFLDHRLELAKHEWARLKANDSLECRNCHSSAAMDLSKQTQRAAEIHTRYLLPGRATCID
CHKGIAHELPNMQGVEPGWKLPPELEGETLPSASAIDELKRVMDEAHSAALAN