Protein Info for SMa1211 in Sinorhizobium meliloti 1021

Annotation: FixG iron sulfur membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 44 to 508 (465 residues), 545.4 bits, see alignment E=5.1e-168 PF12801: Fer4_5" amino acids 106 to 137 (32 residues), 22.8 bits, see alignment (E = 1.8e-08) PF13746: Fer4_18" amino acids 227 to 331 (105 residues), 129.2 bits, see alignment E=2.1e-41 PF13534: Fer4_17" amino acids 231 to 295 (65 residues), 23.3 bits, see alignment E=1.9e-08 PF11614: FixG_C" amino acids 394 to 519 (126 residues), 84.6 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 100% identical to FIXG_RHIME: Nitrogen fixation protein FixG (fixG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa1211)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18396 at UniProt or InterPro

Protein Sequence (524 amino acids)

>SMa1211 FixG iron sulfur membrane protein (Sinorhizobium meliloti 1021)
MLHQPKTKATVGRLDAETVNAARVRGPLYEKRRKIFPKRAEGRFRRFKWLVMLVTLGIYY
LTPWIRWDRGAHAPDQAVLIDLASRRFYFFFIEIWPQEFFFVAGLLVMAGFGLFLVTSAV
GRAWCGYACPQTVWVDLFLVVERFIEGDRNARMRLDAGPWSLDKIRKRVAKHAIWVAIGV
ATGGAWIFYFADAPSLMSSLVALDAPPVAYTTIGILTATTYVFGGLMREQVCTYMCPWPR
IQAAMLDENSLVVTYNDWRGEPRSRHAKKAAAAGEVVGDCVDCNACVAVCPMGIDIRDGQ
QLECITCALCIDACDGVMDKLGRERGLISYATLSDYAANMALATSGGTAAIDPSRVRNAH
GAFRDKVRHLNWRIVFRPRVLVYFGVWATVGFGLLFGLLARDRLELNVLHDRNPQFVVES
DGSVRNGYMVKLLNMIPEQRTISLTIEGMPAATMRVAGQATGDGRRVTIGVEPDKVTPLK
VFVTLPKGRFAEAEEGFSLIAEDPSSHERDVYQANFNLPGAAGR